PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019094-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 1017aa    MW: 112767 Da    PI: 4.8496
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019094-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.6e-184995148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  AHYPO_019094-RA 49 RGQWTSEEDEILRKAVERFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 95
                     89*****************************9.************986 PP

2Myb_DNA-binding58.91.1e-18101147148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W+++Ed+++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  AHYPO_019094-RA 101 KGPWSKQEDDIIVQMVEKYGPKKWSTIAQSLP-GRIGKQCRERWHNHL 147
                      79******************************.*************97 PP

3Myb_DNA-binding50.25.7e-16153195145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   ++++ gRt++ +k++w+
  AHYPO_019094-RA 153 KEAWTQEEELVLIRAHQIHGNR-WAELTKYLP-GRTDNAIKNHWN 195
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.884495IPR017930Myb domain
SuperFamilySSF466899.33E-1847109IPR009057Homeodomain-like
SMARTSM007177.0E-154897IPR001005SANT/Myb domain
PfamPF002491.8E-154995IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2451112IPR009057Homeodomain-like
CDDcd001676.64E-145295No hitNo description
PROSITE profilePS5129431.04196151IPR017930Myb domain
SuperFamilySSF466897.86E-3198194IPR009057Homeodomain-like
SMARTSM007177.3E-18100149IPR001005SANT/Myb domain
PfamPF002493.3E-17101147IPR001005SANT/Myb domain
CDDcd001671.99E-15103147No hitNo description
Gene3DG3DSA:1.10.10.602.8E-26113155IPR009057Homeodomain-like
PROSITE profilePS5129419.935152202IPR017930Myb domain
SMARTSM007175.5E-15152200IPR001005SANT/Myb domain
PfamPF002496.8E-14153196IPR001005SANT/Myb domain
CDDcd001671.10E-11155195No hitNo description
Gene3DG3DSA:1.10.10.602.6E-21156202IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1017 aa     Download sequence    Send to blast
MESDKKIAAS LPPQPPPSLP TSLNGANNAF PYGRPMHGRT TGPTRRSTRG QWTSEEDEIL  60
RKAVERFKGK NWKKIAECFK DRTDVQCLHR WQKVLNPELI KGPWSKQEDD IIVQMVEKYG  120
PKKWSTIAQS LPGRIGKQCR ERWHNHLNPS INKEAWTQEE ELVLIRAHQI HGNRWAELTK  180
YLPGRTDNAI KNHWNSSVKK KLDSYIASGL LAQFEGLPLV SHQSQSIHAA SVLVQQSSEG  240
GSVFKDTTEV ESSECSQVGC SQTASDISNT ACQTKEDFLL SEESDQGKLQ NTSPTASISE  300
QYYKPVEDMT FTIPDIPFEF SCSPKFLEDN FSGEPACADG TSAFGAISLP NIPSMDLGAD  360
SSTLPGNYFL ADSMNDTVHG PSHRSIEYDA FASVDTMAIN SDAPGPKQTA EEGCSEFLQD  420
KDGNRCSLNL TNGSDIIDMC RYRDYITFQT IYQLCETSGN IASQFNNPLD TMMEASNFER  480
FSCENDLLES KDCDQRNESL GVSDAQDIAN VGETLVSAHN NSNSLCHDHV DVGFPEQIEL  540
KRQSKFVSVN TFGSETTYNQ QTHCDVVERP VNTTREQGAG NLCYEPPRFP CLDIPFFSCD  600
LAQSGNDAQQ EFSPLGIRQL MMSSKLWDSP SSDDSPDAIL KSAAKTFATP SILKKRHRDL  660
LSPLSPFSER RFDKKTESNA KQRFLCTSRL TNEFSRLDVM FDETLEGKEP ASPTNDQNNR  720
ASIENKENIC PAFEGSREEE KHNHEELEDK TSEGDKKDMK ATEKEGYLER HSEESVHEYC  780
ASETPKGVLV ERPIIEMQFS SPDGAGPKGG SEAGDRTLDV HSLTNASKQA TTSDSMIHKA  840
KSFVNPSLVD CLVNEVGSEN LNFFGSTPFR RSLESPSAFK SPWFFSSAVT CPRFDTDITV  900
EDIGIFMSPG ERGLDAIGLM KQINEQSADA YAEAREVLGN ETPESILRAR RFNSQNAESK  960
SLGLHLASNV SISDFQAERR VLDFSECGTP AKAPEKGKTI ATANSSSPSC LLKSYR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-69492026159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-69492026159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667918.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_010667925.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0J8D1H60.0A0A0J8D1H6_BETVU; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein